Overview

  • Product name
    Recombinant Human Orai2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSW RKLYLSRAKLKASSRTSALLSGFAMVAMVEVQLETQYQYPRPLLIAFSAC TTVLVAVHLFALLISTCILPNVEAVSNIHNLNSISESPHERMHPYIELAW GFSTVLGILLFLAEVVLLCWIKFLPVDARRQPGPPPGPGSHTGWQAALVS TIIMVPVGLIFVVFTIHFYRSLVRHKTERHNREIEELHKLKVQLDGHERS LQVL
    • Amino acids
      1 to 254
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164229 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C7orf19
    • CAP binding protein complex interacting protein 2
    • CAP-binding protein complex-interacting protein 2
    • CBCIP 2
    • CBCIP2
    • Chromosome 7 open reading frame 19
    • FLJ12474
    • FLJ14733
    • FLJ44818
    • H_NH0514P08.8
    • MEM142B
    • Orai 2
    • ORAI calcium release activated calcium modulator 2
    • ORAI2
    • ORAI2_HUMAN
    • Protein orai 2
    • Protein orai-2
    • TMEM 142B
    • TMEM142B
    • Transmembrane protein 142B
    see all
  • Function
    Ca(2+) release-activated Ca(2+)-like (CRAC-like) channel subunit which mediates Ca(2+) influx and increase in Ca(2+)-selective current by synergy with the Ca(2+) sensor, STIM1.
  • Sequence similarities
    Belongs to the Orai family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab164229 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164229 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164229.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up