Description

  • Product name

    Recombinant Human ORC1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAHYPTRLTTRKTYSWVGRPLLDRKLHYQTYREMCVKTEGCSTEIHIQIG QFVLIEGDDDENPYVAKLLELFEDDSDPPPKKRARVQWFVRFCEVPACKR HLLGRKPGAQ
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      1 to 110
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112336 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names

    • HSORC1
    • MmORC1
    • orc1
    • ORC1_HUMAN
    • ORC1L
    • Origin Recognition Complex 1
    • Origin recognition complex subunit 1
    • Origin recognition complex subunit 1 (yeast homolog) like
    • Origin recognition complex subunit 1 homolog
    • Origin recognition complex subunit 1 like
    • Origin recognition complex subunit 1 like (S. cerevisia
    • Origin recognition complex subunit 1 S. cerevisiae homolog like
    • Origin recognition complex, subunit 1 like (yeast)
    • PARC1
    • Replication control protein 1
    see all
  • Function

    Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication.
  • Sequence similarities

    Belongs to the ORC1 family.
    Contains 1 BAH domain.
  • Developmental stage

    Expression is cell-cycle regulated, it starts to accumulate in mid-G1 phase, reaches a peak at the G1/S boundary, and decreases to a basal level in S phase (at protein level).
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab112336 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab112336 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112336.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up