Overview

  • Product name

    Recombinant Human ORC2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSKPELKEDKMLEVHFVGDDDVLNHILDREGGAKLKKERAQLLVNPKKII KKPEYDLEEDDQEVLKDQNYVEIMGRDVQESLKNGSATGGGNKVYSFQNR KHSEKMAKLASELAKTPQKSVSFSLKNDPEITINVPQSSKGHSASDKVQP KNNDKSEFLSTAPRSLRKRLIVPRSHSDSESEYSASNSEDDEGVAQEHEE DTNAVIFSQKIQAQNRVVSAPVGKETPSKRMKRDKTSDLVEEYFEAHSSS KVLTSDRTLQKLKRAKLDQQTLRNLLSKVSPSFSAELKQLNQQYEKLFHK WMLQLHLGFNIVLYGLGSKRDLLERFRTTMLQDSIHVVINGFFPGISVKS VLNSITEEVLDHMGTFRSILDQLDWIVNKFKEDSSLELFLLIHNLDSQML RGEKSQQIIGQLSSLHNIYLIASIDHLNAPLMWDHAKQSLFNWLWYETTT YSPYTEETSYENSLLVKQSGSLPLSSLTHVLRSLTPNARGIFRLLIKYQL DNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKG TDGVEYLLIPVDNGTLTDFLEKEEEEA
    • Molecular weight

      89 kDa including tags
    • Amino acids

      1 to 577

Specifications

Our Abpromise guarantee covers the use of ab132050 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • orc2
    • ORC2_HUMAN
    • ORC2L
    • Origin of replication 2 (yeast homolog) like
    • Origin recognition complex protein 2 homolog
    • Origin recognition complex subunit 2
    • Origin recognition complex subunit 2 isoform B
    • Origin recognition complex subunit 2 like (yeast)
    • Origin recognition complex, subunit 2 homolog
    • Origin recognition complex, subunit 2, S. cerevisiae, homolog of
    • Origin recognition complex, subunit 2-like (S. cerevisiae)
    see all
  • Function

    Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication.
  • Sequence similarities

    Belongs to the ORC2 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab132050 on a 12.5% gel stained with Coomassie Blue.

References

ab132050 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132050.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up