Description

  • Product name

    Recombinant Human ORC3L protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MATSSMSKGCFVFKPNSKKRKISLPIEDYFNKGKNEPEDSKLRFETYQLI WQQMKSENERLQEELNKNLFDNLIEFLQKSHSGFQKNSRDLGGQIKLREI PTAALVLGVNVTDHDLTFGSLTEALQNNVTPYVVSLQAKDCPDMKHFLQK LISQLMDCCVDIKSKEEESVHVTQRKTHYSMDSLSSWYMTVTQKTDPKML SKKRTTSSQWQSPPVVVILKDMESFATKVLQDFIIISSQHLHEFPLILIF GIATSPIIIHRLLPHAVSSLLCIELFQSLSCKEHLTTVLDKLLLTTQFPF KINEKVLQVLTNIFLYHDFSVQNFIKGLQLSLLEHFYSQPLSVLCCNLPE AKRRINFLSNNQCENIRRLPSFRRYVEKQASEKQVALLTNERYLKEETQL LLENLHVYHMNYFLVLRCLHKFTSSLPKYPLGRQIRELYCTCLEKNIWDS EEYASVLQLLRMLAKDELMTILEKCFKVFKSYCENHLGSTAKRIEEFLAQ FQSLDAETKEEEDASGSQPKGLQKTDLYHLQKSLLEMKELRRSKKQTKFE VLRENVVNFIDCLVREYLLPPETQPLHEVVYFSAAHALREHLNAAPRIAL HTALNNPYYYLKNEALKSEEGCIPNIAPDICIAYKLHLECSRLINLVDWS EAFATVVTAAEKMDANSATSEEMNEIIHARFIRAVSELELLGFIKPTKQK TDHVARLTWGGC
    • Predicted molecular weight

      109 kDa including tags
    • Amino acids

      1 to 712

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132265 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Homolog of Latheo
    • homolog of latheo, Drosophila
    • LAT
    • LATHEO
    • LATHEO, drosophila, homolog of
    • orc3
    • ORC3_HUMAN
    • ORC3L
    • Origin recognition complex subunit 3
    • Origin recognition complex subunit 3 honolog
    • Origin Recognition Complex Subunit 3 Isoform 1
    • Origin recognition complex subunit 3 like
    • Origin recognition complex subunit Latheo
    • Origin Recognition Complex, subunit 3, S. cerevisiae, homolog of
    • Origin recognition complex, subunit 3-like (S. cerevisiae)
    • Origin recognition complex, subunit 3-like (yeast)
    see all
  • Function

    Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent, however specific DNA sequences that define origins of replication have not been identified so far. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication.
  • Sequence similarities

    Belongs to the ORC3 family.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132265 stained with Coomassie Blue.

References

ab132265 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132265.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up