Description

  • Product name

    Recombinant Human ORMDL3 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNVGTAHSEVNPNTRVMNSRGIWLSYVLAIGLLHIVLLSIPFVSVPVVWT LTNLIHNMGMYIFLHTVKGTPFETPDQGKARLLTHWEQMDYGVQFTASRK FLTITPIVLYFLTSFYTKYDQIHFVLNTVSLMSVLIPKLPQLHGVRIFGI NKY
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      1 to 153
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164963 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ORM1 (S. cerevisiae)-like 3
    • ORM1-like 3
    • ORM1-like 3 (S. cerevisiae)
    • ORM1-like protein 3
    • ORMDL sphingolipid biosynthesis regulator 3
    • Ormdl3
    • ORML3_HUMAN
    • OTTHUMP00000164334
    see all
  • Function

    Negative regulator of sphingolipid synthesis. May indirectly regulate endoplasmic reticulum-mediated Ca(+2) signaling.
  • Tissue specificity

    Widely expressed. Expressed in adult and fetal heart, brain, lung, liver, skeletal muscle and kidney. Expressed in adult pancreas and placenta and in fetal spleen abd thymus.
  • Involvement in disease

    Genetic variations in ORMDL3 are associated with susceptibility to asthma (ASTHMA) [MIM:600807]. The most common chronic disease affecting children and young adults. It is a complex genetic disorder with a heterogeneous phenotype, largely attributed to the interactions among many genes and between these genes and the environment. It is characterized by recurrent attacks of paroxysmal dyspnea, with weezing due to spasmodic contraction of the bronchi.
  • Sequence similarities

    Belongs to the ORM family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab164963 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164963 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164963.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up