Recombinant Human Ornithine Carbamoyltransferase/OTC protein (Tagged) (ab235822)

Description

  • Product name

    Recombinant Human Ornithine Carbamoyltransferase/OTC protein (Tagged)
    See all Ornithine Carbamoyltransferase/OTC proteins and peptides
  • Purity

    > 90 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      NKVQLKGRDLLTLKNFTGEEIKYMLWLSADLKFRIKQKGEYLPLLQGKSL GMIFEKRSTRTRLSTETGFALLGGHPCFLTTQDIHLGVNESLTDTARVLS SMADAVLARVYKQSDLDTLAKEASIPIINGLSDLYHPIQILADYLTLQEH YSSLKGLTLSWIGDGNNILHSIMMSAAKFGMHLQAATPKGYEPDASVTKL AEQYAKENGTKLLLTNDPLEAAHGGNVLITDTWISMGQEEEKKKRLQAFQ GYQVTMKTAKVAASDWTFLHCLPRKPEEVDDEVFYSPRSLVFPEAENRKW TIMAVMVSLLTDYSPQLQKPKF
    • Predicted molecular weight

      52 kDa including tags
    • Amino acids

      33 to 354
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature chain lacking the transit peptide. N-terminal 6xHis-SUMO-tagged

Specifications

Our Abpromise guarantee covers the use of ab235822 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Previously labelled as Ornithine Carbamoyltransferase. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • EC 2.1.3.3
    • MGC129967
    • MGC129968
    • MGC138856
    • OCTD
    • Ornithine Carbamoyltransferase
    • Ornithine carbamoyltransferase mitochondrial
    • Ornithine carbamoyltransferase, mitochondrial
    • Ornithine transcarbamylase
    • Otc
    • OTC_HUMAN
    • OTCase
    see all
  • Tissue specificity

    Mainly expressed in liver and intestinal mucosa.
  • Pathway

    Nitrogen metabolism; urea cycle; L-citrulline from L-ornithine and carbamoyl phosphate: step 1/1.
  • Involvement in disease

    Ornithine carbamoyltransferase deficiency
  • Sequence similarities

    Belongs to the ATCase/OTCase family.
  • Post-translational
    modifications

    Acetylation at Lys-88 negatively regulates ornithine carbamoyltransferase activity in response to nutrient signals.
  • Cellular localization

    Mitochondrion matrix.
  • Information by UniProt

Images

  • ab235822 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab235822 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235822.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up