Description

  • Product name

    Recombinant Human Ornithine Decarboxylase/ODC protein
    See all Ornithine Decarboxylase/ODC proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    As determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGSMNNFGNEEFDCHFLDEGFTAKDILDQKINEVSSSDD KDAFYVADLGDILKKHLRWLKALPRVTPFYAVKCNDSKAIVKTLAATGTG FDCASKTEIQLVQSLGVPPERIIYANPCKQVSQIKYAANNGVQMMTFDSE VELMKVARAHPKAKLVLRIATDDSKAVCRLSVKFGATLRTSRLLLERAKE LNIDVVGVSFHVGSGCTDPETFVQAISDARCVFDMGAEVGFSMYLLDIGG GFPGSEDVKLKFEEITGVINPALDKYFPSDSGVRIIAEPGRYYVASAFTL AVNIIAKKIVLKEQTGSDDEDESSEQTFMYYVNDGVYGSFNCILYDHAHV KPLLQKRPKPDEKYYSSSIWGPTCDGLDRIVERCDLPEMHVGDWMLFENM GAYTVAAASTFNGFQRPTIYYVMSGPAWQLMQQFQNPDFPPEVEEQDAST LPVSCAWESGMKRHRAACASASINVLEHHHHHH
    • Predicted molecular weight

      54 kDa including tags
    • Amino acids

      1 to 461
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab185390 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Liquid
  • Additional notes

    Previously labelled as Ornithine Decarboxylase. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride

    Supplied as a 0.2 µM filtered solution

General Info

  • Alternative names

    • DCOR_HUMAN
    • Dodc1
    • ODC
    • Odc 1
    • Odc1
    • ODC2
    • Ornithine decarboxylase
    • Ornithine decarboxylase 1
    • Ornithine decarboxylase 2
    • Ornithine decarboxylase structural 1
    • RNODC
    see all
  • Pathway

    Amine and polyamine biosynthesis; putrescine biosynthesis via L-ornithine pathway; putrescine from L-ornithine: step 1/1.
  • Sequence similarities

    Belongs to the Orn/Lys/Arg decarboxylase class-II family.
  • Post-translational
    modifications

    S-Nitrosylation inhibits the enzyme. S-Nitrosylated in vitro on 4 cysteine residues.
  • Information by UniProt

References

ab185390 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185390.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up