Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSHMQIPLCANLVPVPITNATLDRITGKW FYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQNQCFYN SSYLNVQRENGTVSRYEGGREHVAHLLFLRDTKTLMFGSYLDDEKNWGLS FYADKPETTKEQLGEFYEALDCLCIPRSDVMYTDWKKDKCEPLEKQHEKE RKQEEGES
    • Molecular weight

      24 kDa including tags
    • Amino acids

      19 to 201
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167843 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 95 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • AGP 2
    • AGP B
    • AGP B'
    • AGP2
    • Alpha 1 acid glycoprotein 2
    • Alpha 1 acid glycoprotein type 2
    • OMD 2
    • ORM 2
    • Orosomucoid2
    see all
  • Relevance

    Orosomucoid 2 is a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however Orosomucoid 2 appears to function in modulating the activity of the immune system during the acute-phase reaction.
  • Cellular localization

    Secreted

Images

  • 15% SDS-PAGE analysis of ab167843 (3µg).

References

ab167843 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167843.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up