Description

  • Product name

    Recombinant Human Orosomucoid 2 protein (His tag)
    See all Orosomucoid 2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity of ab185425 is greater than 95%, as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Mammalian
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      QIPLCANLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFY FTPNKTEDTIFLREYQTRQNQCFYNSSYLNVQRENGTVSRYEGGREHVAH LLFLRDTKTLMFGSYLDDEKNWGLSFYADK PETTKEQLGEFYEALDCLCIPRSDVMYTDWKKDKCEPLEKQHEKERKQEE GESVDHHHHHH
    • Predicted molecular weight

      23 kDa including tags
    • Amino acids

      19 to 201
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Mature protein.

Specifications

Our Abpromise guarantee covers the use of ab185425 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Reconstitute for long term storage.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from an 0.2 µM filtered solution.

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 3X PBS. Please aliquot the reconstituted solution

General Info

  • Alternative names

    • AGP 2
    • AGP B
    • AGP B'
    • AGP2
    • Alpha 1 acid glycoprotein 2
    • Alpha 1 acid glycoprotein type 2
    • OMD 2
    • ORM 2
    • Orosomucoid2
    see all
  • Relevance

    Orosomucoid 2 is a key acute phase plasma protein. Because of its increase due to acute inflammation, this protein is classified as an acute-phase reactant. The specific function of this protein has not yet been determined; however Orosomucoid 2 appears to function in modulating the activity of the immune system during the acute-phase reaction.
  • Cellular localization

    Secreted

References

ab185425 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185425.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up