Overview

  • Product name

    Recombinant Human ORP2 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      KLFMIYGKWTECLWGIDPVSYESFKKQERRGDHLRKAKLDEDSGKADSDV ADDVPVAQETVQVIPGSKLLWRINTRPPNSAQMYNFTSFTVSLNELETGM
    • Amino acids

      294 to 393
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160697 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as OSBPL2

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ20223
    • KIAA0772
    • MGC4307
    • MGC8342
    • ORP-2
    • ORP2
    • OSBL2_HUMAN
    • OSBP related protein 2
    • OSBP-related protein 2
    • OSBPL2
    • Oxysterol binding protein like 2
    • Oxysterol binding protein related protein 2
    • Oxysterol-binding protein-related protein 2
    see all
  • Function

    Binds phospholipids; exhibits strong binding to phosphatidic acid and weak binding to phosphatidylinositol 3-phosphate (PubMed:11279184). Binds 25-hydroxycholesterol (PubMed:17428193).
  • Tissue specificity

    Widely expressed.
  • Involvement in disease

    Deafness, autosomal dominant, 67
  • Sequence similarities

    Belongs to the OSBP family.
  • Information by UniProt

Images

  • ab160697 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160697 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160697.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up