Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      IIRATSESDGRCWMDALELALKCSSLLKRTMIREGKEHDLSVSSDSTHVT FYGLLRANNLHSGDNFQLNDSEIERQHFKDQDMYSDKSDKENDQEHDESD NEV
    • Amino acids

      244 to 346
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153577 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DKFZp686A11164
    • KIAA1451
    • MGC126578
    • MGC133203
    • MST120
    • MSTP120
    • ORP 8
    • OSBP related protein 8
    • OSBP10
    • OSBPL8
    • Oxysterol binding protein like 8
    • Oxysterol binding protein like protein 8
    • Oxysterol binding protein related protein 8
    see all
  • Relevance

    ORP8 is a member of the oxysterol-binding protein related protein family. In humans, the gene family consists of 12 members, and extensive splice variation increases the number of encoded protein products substantially. The ORPs have been implicated as sterol sensors that regulate a number of cellular functions including sterol and neutral lipid metabolism, intracellular lipid transport, membrane trafficking and cell signaling. ORP8 has been recently shown to act as a sterol sensor that affects the reverse cholesterol transport process via modulation of ABCA1 expression and macrophage cholesterol efflux.
  • Cellular localization

    Endoplasmic reticulum

Images

  • ab153577 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153577 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153577.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up