Overview

  • Product name

    Recombinant Human OS9 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MAAETLLSSLLGLLLLGLLLPASLTGGVGSLNLEELSEMRYGIEILPLPV MGGQSQSSDVVIVSSKYKQRYECRLPAGAIHFQREREEETPAYQGPGIPE LLSPMRDAPCLLKTKDWWTYEFCYGRHIQQYHMEDSEIKGEVLYLGYYQS AFDWDDETAKASKQHRLKRYHSQTYGNGSKCDLNGRPREAEVRFLCDEGA GISGDYIDRVDEPLSCSYVLTIRTPRLCPHPLLRPPPSAAPQAILCHPSL QPEEYMAYVQRQADSKQYGDKIIEELQDLGPQVWSETKSGVAPQKMAGAS PTKDDSKDSDFWKMLNEPEDQAPGGEEVPAEEQDPSPEAADSASGAPNDF QNNVQVKVIRSPADLIRFIEELKGGTKKGKPNIGQEQPVDDAAEVPQREP EKERGDPERQREMEEEEDEDEDEDEDEDERQLLGEFEKELEGILLPSDRD RLRSEVKAGMERELENIIQETEKELDPDGLKKESERDRAMLALTSTLNKL IKRLEEKQSPELVKKHKKKRVVPKKPPPSPQPTGKIEIKIVRPWAEGTEE GARWLTDEDTRNLKEIFFNILVPGAEEAQKERQRQKELESNYRRVWGSPG GEGTGDLDEFDF
    • Molecular weight

      96 kDa including tags
    • Amino acids

      1 to 612

Specifications

Our Abpromise guarantee covers the use of ab132211 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • amplified in osteosarcoma
    • Amplified in osteosarcoma 9
    • ERLEC2
    • OS-9
    • Os9
    • OS9_HUMAN
    • Osteosarcoma amplified 9 endoplasmic reticulum lectin
    • Protein OS-9
    see all
  • Function

    Lectin which functions in endoplasmic reticulum (ER) quality control and ER-associated degradation (ERAD). May bind terminally misfolded non-glycosylated proteins as well as improperly folded glycoproteins, retain them in the ER, and possibly transfer them to the ubiquitination machinery and promote their degradation. Possible targets include TRPV4.
  • Tissue specificity

    Ubiquitously expressed. Found as well in all tumor cell lines analyzed, amplified in sarcomas. Highly expressed in osteosarcoma OSA-CL and rhabdomyosarcoma RH30 cell lines. Isoform 2 is the major isoform detected in all cell types examined.
  • Sequence similarities

    Belongs to the OS-9 family.
    Contains 1 PRKCSH domain.
  • Post-translational
    modifications

    Intramolecular disulfide bonds.
    Isoform 1 and isoform 2 are N-glycosylated.
  • Cellular localization

    Endoplasmic reticulum lumen.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132211 stained with Coomassie Blue.

References

ab132211 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132211.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up