Recombinant Human OSCAR/Osteoclast-associated receptor protein (His tag) (ab235879)

Description

  • Product name

    Recombinant Human OSCAR/Osteoclast-associated receptor protein (His tag)
    See all OSCAR/Osteoclast-associated receptor proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab235879 was purified by using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      DITPSVPPASYHPKPWLGAQPATVVTPGVNVTLRCRAPQPAWRFGLFKPG EIAPLLFRDVSSELAEFFLEEVTPAQGGSYRCCYRRPDWGPGVWSQPSDV LELLVTEELPRPSLVALPGPVVGPGANVSLRCAGRLRNMSFVLYREGVAA PLQYRHSAQPWADFTLLGARAPGTYSCYYHTPSAPYVLSQRSEVLVISWE GEGPEARPASSAPGMQAPGPPPSDPGAQAPSLSSFRPRGLVLQPLLPQTQ DSWDPAPPPSDPGVHHHHHH
    • Predicted molecular weight

      29 kDa including tags
    • Amino acids

      19 to 282
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_001269278. Full length mature chain without signal peptide.

Specifications

Our Abpromise guarantee covers the use of ab235879 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as OSCAR

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: PBS, 10% Glycerol

General Info

  • Alternative names

    • hOSCAR
    • hOSCARM2
    • hOSCARM3
    • mOSCAR
    • Oscar
    • Oscar protein
    • OSCAR_HUMAN
    • OSCARS1
    • OSCARS2
    • Osteoclast associated immunoglobulin like receptor
    • Osteoclast associated receptor
    • Osteoclast-associated immunoglobulin-like receptor
    • Osteoclast-associated receptor
    • PIgR-3
    • PIGR3
    • Poly Ig receptor 3
    • Poly-Ig receptor 3
    • Polymeric immunoglobulin receptor 3
    see all
  • Function

    Regulator of osteoclastogenesis which plays an important bone-specific function in osteoclast differentiation.
  • Sequence similarities

    Belongs to the leukocyte receptor complex/polymeric immunogobulin receptor (PIR/LRC) family.
    Contains 2 Ig-like (immunoglobulin-like) domains.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab235879.

    40-57 kDa (Under reducing conditions)

References

ab235879 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235879.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up