Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPAVLGFEGSANKIGVGVVRDGKVLANPRRTYVTPPGTGFLPGDTARHHR AVILDLLQEALTESGLTSQDIDCIAYTKGPGMGAPLVSVAVVARTVAQLW NKPLVGVNHCIGHIEMGRLITGATSPTVLYVSGGNTQVIAYSEHRYRIFG ETIDIAVGNCLDRFARVLKISNDPSPGYNIEQMAKRGKKLVELPYTVKGM DVSFSGILSFIEDVAHRMLATGECTPEDLCFSLQETVFAMLVEITERAMA HCGSQEALIVGGVGCNVRLQEMMATMCQERGARLFATDERFCIDNGAMIA QAGWEMFRAGHRTPLSDSGVTQRYRTDEVEVTWRD
    • Molecular weight

      63 kDa including tags
    • Amino acids

      1 to 335

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132776 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ20411
    • GCPL-1
    • GCPL1
    • hOSGEP
    • KAE1
    • O sialoglycoprotein endopeptidase
    • OSGEP
    • OSGEP_HUMAN
    • OSGEP1
    • Pasteurella haemolytica metalloprotease homolog with glycoprotein substrates/gpc-like protein 1
    • Probable O sialoglycoprotein endopeptidase
    • Probable tRNA threonylcarbamoyladenosine biosynthesis protein osgep
    • PRSMG1
    • Prsmg1/Gcpl1
    • t(6)A37 threonylcarbamoyladenosine biosynthesis protein osgep
    see all
  • Function

    Required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine.
  • Tissue specificity

    Widely expressed at low level. Expressed in heart, placenta, liver, kidney, lung, brain, skeletal muscle and pancreas.
  • Sequence similarities

    Belongs to the KAE1 / YgjD family.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132776 stained with Coomassie Blue.

References

ab132776 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132776.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up