Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSSSRKDHLGASSSEPLPVIIVGNGPSGICLSYLLSGYTPYTKPDAIHPH PLLQRKLTEAPGVSILDQDLDYLSEGLEGRSQSPVALLFDALLRPDTDFG GNMKSVLTWKHRKEHAIPHVVLGRNLPGGAWHSIEGSMVILSQGQWMGLP DLEVKDWMQKKRRGLRNSRATAGDIAHYYRDYVVKKGLGHNFVSGAVVTA VEWGTPDPSSCGAQDSSPLFQVSGFLTRNQAQQPFSLWARNVVLATGTFD SPARLGIPGEALPFIHHELSALEAATRVGAVTPASDPVLIIGAGLSAADA VLYARHYNIPVIHAFRRAVDDPGLVFNQLPKMLYPEYHKVHQMMREQSIL SPSPYEGYRSLPRHQLLCFKEDCQAVFQDLEGVEKVFGVSLVLVLIGSHP DLSFLPGAGADFAVDPDQPLSAKRNPIDVDPFTYQSTRQEGLYAMGPLAG DNFVRFVQGGALAVASSLLRKETRKPP
    • Amino acids
      1 to 477
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162283 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1700012B18Rik
    • BDGI
    • Bone marrow stromal cell derived growth inhibitor
    • huOKL38
    • OKL 38
    • OKL38
    • OSGIN 1
    • OTTHUMP00000174992
    • OTTHUMP00000174993
    • Ovary kidney and liver protein 38
    • Oxidative stress induced growth inhibitor 1
    • Pregnancy induced growth inhibitor
    • Pregnancy induced growth inhibitor OKL38
    see all
  • Relevance
    OSGIN1 (Oxidative stress-induced growth inhibitor 1) regulates the differentiation and proliferation of normal cells through the regulation of cell death.

Images

  • ab162283 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162283 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162283.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up