Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPR RYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV
    • Molecular weight

      37 kDa including tags
    • Amino acids

      1 to 100
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152231 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BGLAP
    • BGP
    • Bone gamma carboxyglutamate (gla) protein
    • Bone gamma carboxyglutamate gla protein osteocalcin
    • Bone gamma carboxyglutamate protein
    • Bone Gla protein
    • Gamma carboxyglutamic acid containing protein
    • Gamma-carboxyglutamic acid-containing protein
    • OC
    • OCN
    • OSTCN_HUMAN
    • Osteocalcin
    • OTTHUMP00000016586
    • PMF1
    see all
  • Function

    Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.
  • Sequence similarities

    Belongs to the osteocalcin/matrix Gla protein family.
    Contains 1 Gla (gamma-carboxy-glutamate) domain.
  • Post-translational
    modifications

    Gamma-carboxyglutamate residues are formed by vitamin K dependent carboxylation. These residues are essential for the binding of calcium.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152231 stained with Coomassie Blue.

References

This product has been referenced in:

  • Khashayar P  et al. Fabrication and Verification of Conjugated AuNP-Antibody Nanoprobe for Sensitivity Improvement in Electrochemical Biosensors. Sci Rep 7:16070 (2017). Read more (PubMed: 29167431) »
See 1 Publication for this product

Customer reviews and Q&As

Abreviews
Application
Functional Studies
The protein was used for in vitro treatment of mouse bone tissue. After treatment, WB was performed using DMP-1 as a marker of osteoblast activity. Attached is the figure showing the difference between control vs. treated in terms of signal intensity.

Abcam user community

Verified customer

Submitted Jan 21 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up