Description

  • Product name

    Recombinant human OTUD6B protein
  • Biological activity

    Specific Activity: 24 pmole/min/mg.

  • Purity

    >= 80 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EPRVRVEGWKVPTSRCRFLLARVLGYLVVMEAVLTEELDEEEQLLRRHRK EKKELQAKIQGMKNAVPKNDKKRRKQLTEDVAKLEKEMEQKHREELEQLK LTTKENKIDSVAVNISNLVLENQPPRISKAQKRREKKAALEKEREERIAE AEIENLTGARHMESEKLAQILAARQLEIKQIPSDGHCMYKAIEDQLKEKD CALTVVALRSQTAEYMQSHVEDFLPFLTNPNTGDMYTPEEFQKYCEDIVN TAAWGGQLELRALSHILQTPIEIIQADSPPIIVGEEYSKKPLILVYMRHA YGLGEHYNSVTRLVNIVTENCS
    • Predicted molecular weight

      39 kDa including tags
    • Amino acids

      2 to 323
    • Tags

      His-DDDDK tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab198664 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Liquid
  • Additional notes

    Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 1.7% Imidazole
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 20% Glycerol, 0.05% DTT, 0.02% Potassium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • CGI-77
    • DUBA-5
    • DUBA5
    • OTU domain containing protein 6B
    • OTU domain-containing protein 6B
    • OTU6B_HUMAN
    • OTUD6B
    see all
  • Sequence similarities

    Contains 1 OTU domain.
  • Information by UniProt

Images

  • 10% SDS-PAGE with Coomassie staining: 3 µg ab198664.

  • Example of specific activity of ab198664.

References

ab198664 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198664.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up