Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MMSYLKQPPYGMNGLGLAGPAMDLLHPSVGYPATPRKQRRERTTFTRSQL DVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQSG SGTKSRPAKKKSSPVRESSGSESSGQFTPPAVSSSASSSSSASSSSANPA AAAAAGLGGNPVAAASSLSTPAASSIWSPASISPGSAPASVSVPEPLAAP SNTSCMQRSVAAGAATAAASYPMSYGQGGSYGQGYPTPSSSYFGGVDCSS YLAPMHSHHHPHQLSPMAPSSMAGHHHHHPHAHHPLSQSSGHHHHHHHHH HQGYGGSGLAFNSADCLDYKEPGAAAASSAWKLNFNSPDCLDYKDQASWR FQVL
    • Molecular weight

      64 kDa including tags
    • Amino acids

      1 to 354

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132317 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • FLJ38361
    • Homeobox protein OTX 1
    • Homeobox protein OTX1
    • MGC15736
    • Orthodenticle 1
    • Orthodenticle homeobox 1
    • Orthodenticle homolog 1
    • Orthodenticle1
    • Otx 1
    • otx1
    • OTX1_HUMAN
    see all
  • Function

    Probably plays a role in the development of the brain and the sense organs. Can bind to the BCD target sequence (BTS): 5'-TCTAATCCC-3'.
  • Tissue specificity

    Expressed in brain.
  • Sequence similarities

    Belongs to the paired homeobox family. Bicoid subfamily.
    Contains 1 homeobox DNA-binding domain.
  • Developmental stage

    Embryo.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132317 stained with Coomassie Blue.

References

ab132317 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132317.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up