Description

  • Product name

    Recombinant Human OXLD1 protein
  • Purity

    > 90 % SDS-PAGE.
    ab181933 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSPGAQAPDGRRKFGTDHVEVGSQAGADG TRPPKASLPPELQPPTNCCMSGCPNCVWVEYADRLLQHFQDGGERALAAL EEHVADENLKAFLRMEIRLHTRCGG
    • Predicted molecular weight

      13 kDa including tags
    • Amino acids

      46 to 147
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_001034931

Specifications

Our Abpromise guarantee covers the use of ab181933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 50% Glycerol, 0.32% Tris HCl, 0.88% Sodium chloride, 0.02% DTT

General Info

  • Alternative names

    • C17orf90
    • Oxidoreductase like domain containing 1
    • Oxidoreductase-like domain-containing protein 1
    • OXLD1
    • OXLD1_HUMAN
    see all
  • Sequence similarities

    Contains 1 Oxidoreductase-like domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab181933.

References

ab181933 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up