Description

  • Product name

    Recombinant Human OXSM protein
  • Purity

    > 90 % SDS-PAGE.
    ab171708 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSKRKFFGTVPISRLHRRVVITGIGLVTP LGVGTHLVWDRLIGGESGIVSLVGEEYKSIPCSVAAYVPRGSDEGQFNEQ NFVSKSDIKSMSSPTIMAIGAAELAMKDSGWHPQSEADQVATGVAIGMGM IPLEVVSETALNFQTKGYNKVSPFFVPKILVNMAAGQVSIRYKLKGPNHA VSTACTTGAHAVGDSFRFIAHGDADVMVAGGTDSCISPLSLAGFSRARAL STNSDPKLACRPFHPKRDGFVMGEGAAVLVLEEYEHAVQRRARIYAEVLG YGLSGDAGHITAPDPEGEGALRCMAAALKDAGVQPEEISYINAHATSTPL GDAAENKAIKHLFKDHAYALAVSSTKGATGHLLGAAGAVEAAFTTLACYY QKLPPTLNLDCSEPEFDLNYVPLKAQEWKTEKRFIGLTNSFGFGGTNATL CIAGL
    • Predicted molecular weight

      48 kDa including tags
    • Amino acids

      28 to 459
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab171708 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 10% Glycerol, 0.88% Sodium chloride

General Info

  • Alternative names

    • 3 oxoacyl ACP synthase, mitochondrial
    • 3 oxoacyl acyl carrier protein synthase
    • 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial
    • Acyl malonyl acyl carrier protein condensing enzyme
    • Beta ketoacyl ACP synthase
    • beta-ketoacyl synthase
    • beta-ketoacyl synthase, mitochondrial
    • Beta-ketoacyl-ACP synthase
    • C80494
    • FASN2D
    • FLJ20604
    • KASI
    • KS
    • OXSM
    • OXSM_HUMAN
    • type II mitochondrial beta ketoacyl synthase
    see all
  • Function

    May play a role in the biosynthesis of lipoic acid as well as longer chain fatty acids required for optimal mitochondrial function.
  • Tissue specificity

    Widely expressed. Higher expression in heart, skeletal muscle, liver and kidney which contain high levels of active mitochondria.
  • Pathway

    Lipid metabolism; fatty acid biosynthesis.
  • Sequence similarities

    Belongs to the beta-ketoacyl-ACP synthases family.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab171708 (3µg).

References

ab171708 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab171708.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up