Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      AAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYL PSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
    • Molecular weight

      15 kDa including tags
    • Amino acids

      32 to 125
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature chain lacking the signal peptide. N-terminal 10xHis-tagged and C-terminal Myc-tagged

Specifications

Our Abpromise guarantee covers the use of ab235823 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: Tris buffer, 50% Glycerol

General Info

  • Alternative names

    • MGC126890
    • MGC126892
    • Neurophysin 1
    • Neurophysin I
    • Ocytocin
    • OT
    • OT NPI
    • OXT
    • Oxytocin Neurophysin preproprotein
    • Oxytocin prepro (neurophysin I)
    • Oxytocin prepropeptide
    • Oxytocin-neurophysin 1
    see all
  • Relevance

    Neurophysin 1 specifically binds oxytocin. Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland. Oxytocin is a posterior pituitary hormone which is synthesized as an inactive precursor in the hypothalamus along with its carrier protein neurophysin I. Together with neurophysin, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis, where it is either stored or secreted into the bloodstream. Oxytocin contracts smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions.
  • Cellular localization

    Secreted

Images

  • ab235823 analyzed by (Tris-Glycine gel) discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

References

ab235823 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235823.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up