Description

  • Product name

    Recombinant Human P cadherin protein (His tag)
    See all P cadherin proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EPCRAVFREAEVTLEAGGAEQEPGQALGKVFMGCPGQEPALFSTDNDDFT VRNGETVQERRSLKERNPLKIFPSKRILRRHKRDWVVAPISVPENGKGPF PQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLD REEIAKYELFGHAVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSV LEGVLPGTSVMQMTATDEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHR STGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILDANDN APMFDPQKYEAHVPENAVGHEVQRLTVTDLDAPNSPAWRATYLIMGGDDG DHFTITTHPESNQGILTTRKGLDFEAKNQHTLYVEVTNEAPFVLKLPTST ATIVVHVEDVNEAPVFVPPSKVVEVQEGIPTGEPVCVYTAEDPDKENQKI SYRILRDPAGWLAMDPDSGQVTAVGTLDREDEQFVRNNIYEVMVLAMDNG SPPTTGTGTLLLTLIDVNDHGPVPEPRQITICNQSPVRQVLNITDKDLSP HTSPFQAQLTDDSDIYWTAEVNEEGDTVVLSLKKFLKQDTYDVHLSLSDH GNKEQLTVIRATVCDCHGHVETCPGPWKGGVDHHHHHH
    • Predicted molecular weight

      70 kDa including tags
    • Amino acids

      25 to 654
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab215619 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Lyophilized from a 0.2 µm filtered solution.

  • Reconstitution
    Always centrifuge tubes before opening. Dissolve the lyophilized protein in ddH2O. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Do not mix by vortex or pipetting.

General Info

  • Alternative names

    • CADH3_HUMAN
    • Cadherin 3
    • Cadherin 3 precursor
    • Cadherin 3 type 1
    • Cadherin-3
    • Cadp
    • Calcium dependent adhesion protein placental
    • CDH 3
    • CDH3
    • CDH3 protein
    • CDHP
    • HJMD
    • P cadherin (placental)
    • P-cadherin
    • PCAD
    • Placental cadherin
    see all
  • Function

    Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
  • Tissue specificity

    Expressed in some normal epithelial tissues and in some carcinoma cell lines.
  • Involvement in disease

    Defects in CDH3 are the cause of hypotrichosis with juvenile macular dystrophy (HJMD) [MIM:601553]. HJMD is a rare autosomal recessive disorder characterized by early hair loss heralding severe degenerative changes of the retinal macula and culminating in blindness during the second to third decade of life.
    Defects in CDH3 are the cause of ectodermal dysplasia with ectrodactyly and macular dystrophy (EEM) [MIM:225280]; also known as EEM syndrome, Albrectsen-Svendsen syndrome or Ohdo-Hirayama-Terawaki syndrome. Ectodermal dysplasia defines a heterogeneous group of disorders due to abnormal development of two or more ectodermal structures. EEM is an autosomal recessive condition characterized by features of ectodermal dysplasia such as sparse eyebrows and scalp hair, and selective tooth agenesis associated with macular dystrophy and ectrodactyly.
  • Sequence similarities

    Contains 5 cadherin domains.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab215619.

    Lane 1: Reducing conditions.

    Lane 2: Non-reducing conditions.

References

ab215619 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab215619.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up