Recombinant Human P protein (ab116803)
- Datasheet
- References
- Protocols
Description
-
Product name
Recombinant Human P protein -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
GKLWQLLALSPLENYSVNLSSHVDSTLLQVDLAGALVASGPSRPGREE HIVVELTQADALGSRWRRPQQVTHNWTVYLNPRRSEHSVMSRTFEVLTRE TV -
Predicted molecular weight
37 kDa including tags -
Amino acids
201 to 300
-
Specifications
Our Abpromise guarantee covers the use of ab116803 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
SDS-PAGE
-
Form
Liquid -
Additional notes
Protein concentration is above or equal to 0.05 mg/ml.
This protein is best used within three months from the date of receipt. -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.79% Tris HCl, 0.3% Glutathione
General Info
-
Alternative names
- BEY
- BEY1
- BEY2
see all -
Function
Could be involved in the transport of tyrosine, the precursor to melanin synthesis, within the melanocyte. Regulates the pH of melanosome and the melanosome maturation. One of the components of the mammalian pigmentary system. Seems to regulate the post-translational processing of tyrosinase, which catalyzes the limiting reaction in melanin synthesis. May serve as a key control point at which ethnic skin color variation is determined. Major determinant of brown and/or blue eye color. -
Involvement in disease
Defects in OCA2 are the cause of albinism oculocutaneous type 2 (OCA2) [MIM:203200]. An autosomal recessive disorder in which the biosynthesis of melanin pigment is reduced in skin, hair, and eyes. Although affected infants may appear at birth to have complete absence of melanin pigment, most patients acquire small amounts of pigment with age. Visual anomalies include decreased acuity and nystagmus. The phenotype is highly variable. The hair of affected individuals may turn darker with age, and pigmented nevi or freckles may be seen. African and African American individuals may have yellow hair and blue-gray or hazel irides. One phenotypic variant, 'brown OCA,' has been described in African and African American populations and is characterized by light brown hair and skin color and gray to tan irides. -
Sequence similarities
Belongs to the CitM (TC 2.A.11) transporter family. -
Cellular localization
Melanosome membrane. - Information by UniProt
Images
Datasheets and documents
References
ab116803 has not yet been referenced specifically in any publications.