Overview

  • Product name

    Recombinant Human p114RhoGEF protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSQGMQRMHLETLQQVDKWPLCGPLACSELLQLTVRSLEGWRKEVLGSIK GAGTSQGGEIHPRSSSGGERAHVKPCSAPQALVVGLGPG
    • Molecular weight

      36 kDa including tags
    • Amino acids

      1 to 89

Specifications

Our Abpromise guarantee covers the use of ab132027 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 114 kDa Rho specific guanine nucleotide exchange factor
    • 114 kDa Rho-specific guanine nucleotide exchange factor
    • ARHGEF 18
    • Arhgef18
    • ARHGI_HUMAN
    • KIAA0521
    • MGC15913
    • p114 Rho GEF
    • p114-Rho-GEF
    • p114RhoGEF
    • Rho guanine nucleotide exchange factor 18
    • Rho specific guanine nucleotide exchange factor p114
    • Rho/Rac guanine nucleotide exchange factor (GEF) 18
    • Rho/Rac guanine nucleotide exchange factor 18
    • SA RhoGEF
    • SA-RhoGEF
    • Septin associated RhoGEF
    • Septin-associated RhoGEF
    see all
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132027 at approximately 35. kDa.

References

ab132027 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132027.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up