Description

  • Product name

    Recombinant Human p115-RhoGEF protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEDFARGAASPGPSRPGLVPVSIIGAEDEDFENELETNSEEQNSQFQSLE QVKRRPAHLMALLQHVALQFEPGPLLCCLHADMLGSLGPKEAKKAFLDFY HSFLEKTAVLRVPVPPNVAFELDRTRADLISEDVQRRFVQEVVQSQQVAV GRQLEDFRSKRLMGMTPWEQELAQLEAWVGRDRASYEARERHVAERLLMH LEEMQHTISTDEEKSAAVVNAIGLYMRHLGVRTKSGDKKSGRNFFRKKVM GNRRSDEPAKTKKGLSSILDAARWNRGEPQVPDFRHLKAEVDAEKPGATD RKGGVGMPSRDRNIGAPGQDTPGVSLHPLSLDSPDREPGADAPLELGDSS PQGPMSLESLAPPESTDEGAETESPEPGDEGEPGRSGLELEPEEPPGWRE LVPPDTLHSLPKSQVKRQEVISELLVTEAAHVRMLRVLHDLFFQPMAECL FFPLEELQNIFPSLDELIEVHSLFLDRLMKRRQESGYLIEEIGDVLLARF DGAEGSWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAFVQEAESRPRCR RLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPTEREKVELAAECCREILH HVNQAVRDMEDLLRLKDYQRRLDLSHLRQSSDPMLSEFKNLDITKKKLVH EGPLTWRVTKDKAVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDG KTMLRPVLRLTSAMTREVATDHKAFYVLFTWDQEAQIYELVAQTVSERKN WCALITETAGSLKVPAPASRPKPRPSPSSTREPLLSSSENGNGGRETSPA DARTERILSDLLPFCRPGPEGQLAATALRKVLSLKQLLFPAEEDNGAGPP RDGDGVPGGGPLSPARTQEIQENLLSLEETMKQLEELEEEFCRLRPLLSQ LGGNSVPQPGCT
    • Predicted molecular weight

      129 kDa including tags
    • Amino acids

      1 to 912

Specifications

Our Abpromise guarantee covers the use of ab132603 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.

    Previously labelled as ARHGEF1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 115 kD protein
    • 115 kDa guanine nucleotide exchange factor
    • ARHG1_HUMAN
    • ARHGEF 1
    • ARHGEF1
    • GEF 1
    • GEF1
    • LBCL 2
    • LBCL2
    • LSC
    • Lsc homolog
    • p115 RhoGEF
    • p115-RhoGEF
    • p115RhoGEF
    • Rho guanine nucleotide exchange factor (GEF) 1
    • Rho guanine nucleotide exchange factor 1
    • Sub1.5
    see all
  • Function

    Seems to play a role in the regulation of RhoA GTPase by guanine nucleotide-binding alpha-12 (GNA12) and alpha-13 (GNA13) subunits. Acts as GTPase-activating protein (GAP) for GNA12 and GNA13, and as guanine nucleotide exchange factor (GEF) for RhoA GTPase. Activated G alpha 13/GNA13 stimulates the RhoGEF activity through interaction with the RGS-like domain. This GEF activity is inhibited by binding to activated GNA12. Mediates angiotensin-2-induced RhoA activation.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Contains 1 DH (DBL-homology) domain.
    Contains 1 PH domain.
    Contains 1 RGSL (RGS-like) domain.
  • Domain

    The RGSL domain, also known as rgRGS domain, is necessary but not sufficient for GAP activity.
    The DH domain is involved in interaction with CCPG1.
  • Post-translational
    modifications

    Phosphorylated by PKCA. Angiotensin-2 induced Tyr-738 phosphorylation is mediated by JAK2.
  • Cellular localization

    Cytoplasm. Membrane. Translocated to the membrane by activated GNA13 or LPA stimulation.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132603 stained with Coomassie Blue.

References

ab132603 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132603.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up