Overview

  • Product name

    Recombinant Human p16 ARC protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSKNTVSSARFRKVDVDEYDENKFVDEEDG GDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVL KVLISFKANDIEKAVQSLDKNGVDLLMKYIYKGFESPSDNSSAMLLQWHE KALAAGGVGSIVRVLTARKTV
    • Molecular weight

      18 kDa including tags
    • Amino acids

      1 to 151
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab124983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab124983 is purified by proprietary chromatographic techniques and sterile filtered.
  • Form

    Liquid
  • Additional notes

    For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Store under desiccating conditions.

    pH: 8.00
    Constituents: 0.02% DTT, 0.32% Tris HCl, 50% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • Actin related protein 2/3 complex subunit 5
    • Actin related protein 2/3 complex subunit 5 (16 kD)
    • Actin related protein 2/3 complex, subunit 5 16kDa
    • Actin-related protein 2/3 complex subunit 5
    • ARC16
    • Arp2/3 complex 16 kDa subunit
    • Arp2/3 protein complex subunit p16
    • ARPC 5
    • Arpc5
    • ARPC5_HUMAN
    • dJ127C7.3
    • MGC88523
    • p16 Arc
    • p16-ARC
    • RP1 127C7.3
    see all
  • Function

    Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks.
  • Sequence similarities

    Belongs to the ARPC5 family.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cell projection.
  • Information by UniProt

References

ab124983 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab124983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up