Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAIYYFK ANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLGI TNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLRLCEKVFD PQNDKPSKWWTCFVKRQFMNKSLSGPGQ
    • Molecular weight

      47 kDa including tags
    • Amino acids

      1 to 178

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132302 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.

     This product was previously labelled as p21-ARC

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Actin related protein 2/3 complex subunit 3
    • ARC21
    • ARP2/3 complex 21 kDa subunit
    • ARP2/3 protein complex subunit p21
    • ARPC3
    see all
  • Relevance

    p21-ARC is part of a complex implicated in the control of actin polymerization in cells. It belongs to a complex composed of ARP2, ARP3, ARPC1, ARPC2, ARPC3, ARPC4 and ARPC5, collectively known as the ARPC3 family. p21-ARC is implicated as an important regulator of growth cone translocation, especially in the CNS (Strasser et al, 2004).
  • Cellular localization

    Cytoplasmic; cytoskeleton

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132302.

References

ab132302 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132302.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up