Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSEPAGDVRQNPCGSKACRRLFGPVDSEQLRRDCDALMAGCIQEARERWN FDFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGRDELGGGRRPGTSPA LLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTSMTDF YHSKRRLIFSKRKPLEHHHHHH
    • Molecular weight
      19 kDa including tags
    • Amino acids
      2 to 164
    • Tags
      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172148 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.20
    Constituents: 0.88% Sodium chloride, 99% Phosphate Buffer

General Info

  • Alternative names
    • CAP20
    • CDK-interacting protein 1
    • CDKI
    • CDKN1
    • Cdkn1a
    • CDN1A_HUMAN
    • CIP1
    • Cyclin Dependent Kinase Inhibitor 1A
    • Cyclin-dependent kinase inhibitor 1
    • Cyclin-dependent kinase inhibitor 1A (P21)
    • Cyclin-dependent kinase inhibitor 1A (p21, Cip1)
    • DNA Synthesis Inhibitor
    • MDA-6
    • MDA6
    • Melanoma differentiation-associated protein
    • Melanoma differentiation-associated protein 6
    • p21
    • P21 protein
    • p21CIP1
    • p21Cip1/Waf1
    • p21WAF
    • PIC1
    • SDI1
    • SLC12A9
    • WAF1
    • Wild type p53 activated fragment 1
    • Wild type p53 activated fragment 1 (WAF1)
    • Wildtype p53-activated fragment 1
    see all
  • Function
    May be the important intermediate by which p53/TP53 mediates its role as an inhibitor of cellular proliferation in response to DNA damage. Binds to and inhibits cyclin-dependent kinase activity, preventing phosphorylation of critical cyclin-dependent kinase substrates and blocking cell cycle progression. Functions in the nuclear localization and assembly of cyclin D-CDK4 complex and promotes its kinase activity towards RB1. At higher stoichiometric ratios, inhibits the kinase activity of the cyclin D-CDK4 complex.
  • Tissue specificity
    Expressed in all adult human tissues, with 5-fold lower levels observed in the brain.
  • Sequence similarities
    Belongs to the CDI family.
  • Domain
    The PIP-box K+4 motif mediates both the interaction with PCNA and the recuitment of the DCX(DTL) complex: while the PIP-box interacts with PCNA, the presence of the K+4 submotif, recruits the DCX(DTL) complex, leading to its ubiquitination.
    The C-terminal is required for nuclear localization of the cyclin D-CDK4 complex.
  • Post-translational
    modifications
    Phosphorylation of Thr-145 by Akt or of Ser-146 by PKC impairs binding to PCNA. Phosphorylation at Ser-114 by GSK3-beta enhances ubiquitination by the DCX(DTL) complex.
    Ubiquitinated by MKRN1; leading to polyubiquitination and 26S proteasome-dependent degradation. Ubiquitinated by the DCX(DTL) complex, also named CRL4(CDT2) complex, leading to its degradation during S phase or following UV irradiation. Ubiquitination by the DCX(DTL) complex is essential to control replication licensing and is PCNA-dependent: interacts with PCNA via its PIP-box, while the presence of the containing the 'K+4' motif in the PIP box, recruit the DCX(DTL) complex, leading to its degradation.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab172148 in 1) Non reducing and 2) Reducing conditions.

References

ab172148 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172148.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up