Overview

  • Product name

    Recombinant Human p26 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MGSTVPRSASVLLLLLLLRRAEQPCGAELTFELPDNAKQCFHEEVEQGVK FSLDYQVITGGHYDVDCYVEDPQGNTIYRETKKQYDSFTYRAEVKGVYQF CFSNEFSTFSHKTVYFDFQVGDEPPILPDMGNRVTALTQMESACVTIHEA LKTVIDSQTHYRLREAQDRARAEDLNSRVSYWSVGETIALFVVSFSQVLL LKSFFTEKRPISRAVHS
    • Amino acids

      1 to 217
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161638 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as TMED3. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C15orf22
    • Integral type I protein
    • Membrane protein p24B
    • p24 family protein gamma 4
    • p24 family protein gamma-4
    • P24B
    • p24g4
    • p24gamma4
    • p26
    • Testis tissue sperm binding protein Li 48e
    • Tmed3
    • TMED3_HUMAN
    • Transmembrane emp24 domain containing protein 3
    • Transmembrane emp24 domain-containing protein 3
    • Transmembrane p24 trafficking protein 3
    • UNQ5357/PRO1078
    see all
  • Function

    Potential role in vesicular protein trafficking, mainly in the early secretory pathway. Contributes to the coupled localization of TMED2 and TMED10 in the cis-Golgi network.
  • Sequence similarities

    Belongs to the EMP24/GP25L family.
    Contains 1 GOLD domain.
  • Cellular localization

    Endoplasmic reticulum-Golgi intermediate compartment membrane. Golgi apparatus > cis-Golgi network membrane. Golgi apparatus > Golgi stack membrane. Endoplasmic reticulum membrane. Cytoplasmic vesicle > COPI-coated vesicle membrane. Probably cycles between compartments of the early secretatory pathway.
  • Information by UniProt

Images

  • ab161638 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161638 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161638.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up