Description

  • Product name

    Recombinant Human P2X2 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRNRRLGVLYRAVQL LILLYFVWYVFIVQKSYQESETGPESSIITKVKGITTSEHKVWDVEEYVK PPEGGSVFSIITRVEATHSQTQGTCPESIRVHNATCLSDADCVAGELDML GNGLRTGRCVPYYQGPSKTCEVFGWCPVEDGASVSQFLGTMAPNFTILIK NSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFKLGFIVEKAGE SFTELAHKGGVIGVIINWDCDLDLPASECNPKYSFRRLDPKHVPASSGYN FRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALT SVGVGSFLCDWILLTFMNKNKVYSHKKFDKMVDTPASEPAQASTPTDPKG LAQL
    • Predicted molecular weight

      71 kDa including tags
    • Amino acids

      1 to 404

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132031 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ATP receptor
    • MGC129601
    • P2RX 2
    • P2RX2
    • P2RX2_HUMAN
    • P2X purinoceptor 2
    • P2X Receptor subunit 2
    • P2X2
    • P2X2a
    • Purinergic receptor
    • Purinergic receptor P2X ligand gated ion channel 2
    • Purinergic receptor P2X2 isoform A
    • Purinergic receptor P2X2 isoform B
    • Purinergic receptor P2X2 isoform C
    • Purinergic receptor P2X2 isoform D
    • Purinergic receptor P2X2 isoform H
    • Purinergic receptor P2X2 isoform I
    see all
  • Function

    Ion channel gated by extracellular ATP involved in a variety of cellular responses, such as excitatory postsynaptic responses in sensory neurons, neuromuscular junctions (NMJ) formation, hearing, perception of taste and peristalsis. In the inner ear, regulates sound transduction and auditory neurotransmission, outer hair cell electromotility, inner ear gap junctions, and K(+) recycling. Mediates synaptic transmission between neurons and from neurons to smooth muscle.
  • Involvement in disease

    Deafness, autosomal dominant, 41
  • Sequence similarities

    Belongs to the P2X receptor family.
  • Cellular localization

    Cell membrane. Localizes to the apical membranes of hair cells in the organ of Corti.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab132031 at approximately 71.2 kDa.

References

ab132031 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132031.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up