Description

  • Product name

    Recombinant Human P2X3 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      HEKAYQVRDTAIESSVVTKVKGSGLYANRVMDVSDYVTPPQGTSVFVIIT KMIVTENQMQGFCPESEEKYRCVSDSQCGPERLPGGGILTGRCVNYSSVL RTCEIQGWCP
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      45 to 154

Specifications

Our Abpromise guarantee covers the use of ab114452 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ATP receptor
    • MGC129956
    • P2rx3
    • P2RX3_HUMAN
    • P2X purinoceptor 3
    • P2X receptor subunit 3
    • P2X3
    • Purinergic receptor
    • Purinergic receptor P2X ligand gated ion channel 3
    • Purinergic receptor P2X3
    • Purinoceptor P2X3
    see all
  • Function

    Receptor for ATP that acts as a ligand-gated ion channel.
  • Sequence similarities

    Belongs to the P2X receptor family.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab114452 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114452 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114452.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up