Overview

  • Product name
    Recombinant Human P2Y13 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNTTVMQGFNRSERCPRDTRIVQLVFPALYTVVFLTGILLNTLALWVFVH IPSSSTFIIYLKNTLVADLIMTLMLPFKILSDSHLAPWQLRAFVCRFSSV IFYETMYVGIVLLGLIAFDRFLKIIRPLRNIFLKKPVFAKTVSIFIWFFL FFISLPNMILSNKEATPSSVKKCASLKGPLGLKWHQMVNNICQFIFWTVF ILMLVFYVVIAKKVYDSYRKSKSKDRKNNKKLEGKVFVVVAVFFVCFAPF HFARVPYTHSQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLC KKFTEKLPCMQGRKTTASSQENHSSQTDNITLG
    • Amino acids
      1 to 333
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162700 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as GPCR GPR86. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • P2RY13
    • FKSG77
    • G protein coupled receptor 86
    • G protein coupled receptor 94
    • G-protein coupled receptor 86
    • G-protein coupled receptor 94
    • GPCR GPR86
    • GPCR1
    • GPR86
    • GPR94
    • HGNC:13661
    • P2RY13
    • P2Y purinoceptor 13
    • P2Y13
    • P2Y13_HUMAN
    • Purinergic receptor P2Y G protein coupled 13
    • SP174
    see all
  • Function
    Receptor for ADP. Coupled to G(i)-proteins. May play a role in hematopoiesis and the immune system.
  • Tissue specificity
    Strong expression in spleen and adult brain. Lower expression in placenta, lung, liver, spinal cord, thymus, small intestine, uterus, stomach, testis, fetal brain, and adrenal gland. Not detected in pancreas, heart, kidney, skeletal muscle, ovary or fetal aorta. Clearly detected in lymph node and bone marrow, weakly detected in peripheral blood mononuclear cells (PBMC) and in peripheral blood leukocytes (PBL), but not detected in polymorphonuclear cells (PMN). In the brain, detected in all brain regions examined.
  • Sequence similarities
    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization
    Cell membrane.
  • Information by UniProt

Images

  • ab162700 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162700 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162700.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up