Description

  • Product name

    Recombinant Human P2Y13 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MNTTVMQGFNRSERCPRDTRIVQLVFPALYTVVFLTGILLNTLALWVFVH IPSSSTFIIYLKNTLVADLIMTLMLPFKILSDSHLAPWQLRAFVCRFSSV IFYETMYVGIVLLGLIAFDRFLKIIRPLRNIFLKKPVFAKTVSIFIWFFL FFISLPNMILSNKEATPSSVKKCASLKGPLGLKWHQMVNNICQFIFWTVF ILMLVFYVVIAKKVYDSYRKSKSKDRKNNKKLEGKVFVVVAVFFVCFAPF HFARVPYTHSQTNNKTDCRLQNQLFIAKETTLFLAATNICMDPLIYIFLC KKFTEKLPCMQGRKTTASSQENHSSQTDNITLG
    • Amino acids

      1 to 333
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162700 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as GPCR GPR86. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • P2RY13
    • FKSG77
    • G protein coupled receptor 86
    • G protein coupled receptor 94
    • G-protein coupled receptor 86
    • G-protein coupled receptor 94
    • GPCR GPR86
    • GPCR1
    • GPR86
    • GPR94
    • HGNC:13661
    • P2RY13
    • P2Y purinoceptor 13
    • P2Y13
    • P2Y13_HUMAN
    • Purinergic receptor P2Y G protein coupled 13
    • SP174
    see all
  • Function

    Receptor for ADP. Coupled to G(i)-proteins. May play a role in hematopoiesis and the immune system.
  • Tissue specificity

    Strong expression in spleen and adult brain. Lower expression in placenta, lung, liver, spinal cord, thymus, small intestine, uterus, stomach, testis, fetal brain, and adrenal gland. Not detected in pancreas, heart, kidney, skeletal muscle, ovary or fetal aorta. Clearly detected in lymph node and bone marrow, weakly detected in peripheral blood mononuclear cells (PBMC) and in peripheral blood leukocytes (PBL), but not detected in polymorphonuclear cells (PMN). In the brain, detected in all brain regions examined.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab162700 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162700 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162700.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up