Overview

  • Product name

    Recombinant Human P2Y14 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MINSTSTQPPDESCSQNLLITQQIIPVLYCMVFIAGILLNGVSGWIFFYV PSSESFIIYLKNIVIADFVMSLTFPFKILGDSGLGPWQLNVFVCRVSAVL FYVNMYVSIVFFGLISFDRYYKIVKPLWTSFIQSVSYSKLLSVIVWMLML LLAVPNIILTNQSVREVTQIKCIELKSELGRKWHKASNYIFVAIFWIVFL LLIVFYTAITKKIFKSHLKSSRNSTSVKKKSSRNIFSIVFVFFVCFVPYH IARIPYTKSQTEAHYSCQSKEILRYMKEFTLLLSAANVCLDPIIYFFLCQ PFREILCKKLHIPLKAQNDLDISRIKRGNTTLESTDTL
    • Amino acids

      1 to 338
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160722 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as GPCR GPR105. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • A330108O13Rik
    • G protein coupled receptor for UDP-glucose
    • G protein-coupled receptor 105
    • G protein-coupled receptor VTR 15-20
    • G-protein coupled receptor 105
    • GPCR GPR105
    • GPR105
    • KIAA0001
    • P2RY14
    • P2Y purinoceptor 14
    • P2Y(14) receptor
    • P2Y14
    • P2Y14 receptor
    • P2Y14_HUMAN
    • Purinergic receptor P2Y G protein coupled 14
    • Similar to TYPE-1 Angiotensin II receptor
    • UDP-glucose receptor
    see all
  • Function

    Receptor for UDP-glucose and other UDP-sugar coupled to G-proteins. Not activated by ATP, ADP, UTP or ATP.
  • Tissue specificity

    Highest expression in the placenta, adipose tissue, stomach and intestine, intermediate levels in the brain, spleen, lung and heart, lowest levels in the kidney.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 1 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab160722 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160722 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160722.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up