Overview

  • Product name

    Recombinant Human p400 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      QVHQRIAELRKAGLWSQRRLPKLQEAPRPKSHWDYLLEEMQWMATDFAQE RRWKVAAAKKLVRTVVRHHEEKQLREERGKKEEQSRLRRIAASTAREIEC FWSNIEQV
    • Amino acids

      743 to 850
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153457 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CAG repeat protein 32
    • CAGH 32
    • CAGH32
    • DKFZP434I225
    • Domino homolog
    • E1A binding protein p400
    • E1A-binding protein p400
    • EP 400
    • EP400
    • EP400_HUMAN
    • FLJ42018
    • FLJ45115
    • hDomino
    • KIAA1498
    • KIAA1818
    • p400 kDa SWI2/SNF2 related protein
    • p400 kDa SWI2/SNF2-related protein
    • P400 SWI2/SNF2 related protein
    • TNRC 12
    • TNRC12
    • Trinucleotide repeat containing 12
    • Trinucleotide repeat containing gene 12 protein
    • Trinucleotide repeat-containing gene 12 protein
    see all
  • Function

    Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. May be required for transcriptional activation of E2F1 and MYC target genes during cellular proliferation. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. May regulate ZNF42 transcription activity.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the SNF2/RAD54 helicase family. SWR1 subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
    Contains 1 HSA domain.
    Contains 1 Myb-like domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab153457 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153457 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153457.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up