Overview

  • Product name
    Recombinant Human p46 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MADISLDELIRKRGAAAKGRLNARPGVGGVRSRVGIQQGLLSQSTRTATF QQRFDARQKIGLSDARLKLGVKDAREKLLQKDARFRIKGKVQDAREMLNS RKQQTTVPQKPRQVADAREKISLKRSSPAAFINPPIGTVTPALKLTKTIQ VPQQKAMAPLHPHPAGMRINVVNNHQAKQNLYDLDEDDDGIASVPTKQMK FAASGGFLHHMAGLSSSKLSMSKALPLTKVVQNDAYTAPALPSSIRTKAL TNMSRTLVNKEEPPKELPAAEPVLSPLEGTKMTVNNLHPRVTEEDIVELF CVCGALKRARLVHPGVAEVVFVKKDDAITAYKKYNNRCLDGQPMKCNLHM NGNVITSDQPILLRLSDSPSMKKESELPRRVNSASSSNPPAEVDPDTILK ALFKSSGASVTTQPTEFKIKL
    • Amino acids
      1 to 421
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164548 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as SKAR. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 46 kDa DNA polymerase delta interaction protein
    • DNA polymerase delta interacting protein 3
    • KIAA1649
    • P46
    • PDIP3_HUMAN
    • PDIP46
    • POLDIP3
    • Polymerase (DNA-directed), delta interacting protein 3
    • Polymerase delta interacting protein 46
    • Polymerase delta-interacting protein 3
    • RNA-binding protein P46
    • S6K1 Aly/REF-like target
    • SKAR
    see all
  • Function
    Is involved in regulation of translation. Is preferentially associated with CBC-bound spliced mRNA-protein complexes during the pioneer round of mRNA translation. Contributes to enhanced translational efficiency of spliced over nonspliced mRNAs. Recruits activated ribosomal protein S6 kinase beta-1 I/RPS6KB1 to newly synthesized mRNA.
  • Sequence similarities
    Contains 1 RRM (RNA recognition motif) domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus. Nucleus speckle. Cytoplasm. Nucleocytoplasmic shuttling protein.
  • Information by UniProt

Images

  • ab164548 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164548 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164548.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up