Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMADPKYADLPGIARNEPDVYETSDLPE DDQAEFDAFAQELEELTSTSVEHIIVNPNAAYDKFKDKRVGTKGLDFSDR IGKTKRTGYESGEYEMLGEGLGVKETPQQKYQRLLHEVQELTTEVEKIKT TVKESATEEKLTPVLLAKQLAALKQQLVASHLEKLLGPDAAINLTDPDGA LAKRLLLQLEATKNSKGGSGGKTTGTPPDSSLVTYELHSRPEQDKFSQAA KVAELEKRLTELETAVRCDQDAQNPLSAGLQGACLMETVELLQAKVSALD LAVLDQVEARLQSVLGKVNEIAKHKASVEDADTQSKVHQLYETIQRWSPI ASTLPELVQRLVTIKQLHEQAMQFGQLLTHLDTTQQMIANSLKDNTTLLT QVQTTMRENLATVEGNFASIDERMKKLGK
    • Molecular weight
      47 kDa including tags
    • Amino acids
      1 to 406
    • Tags
      His tag N-Terminus
    • Additional sequence information
      NCBI Accession No.: NP_006391

Specifications

Our Abpromise guarantee covers the use of ab174453 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab174453 is purified by using conventional chromatography techniques.
  • Form
    Liquid
  • Additional notes

    Previously labelled as Dynamitin. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • 50 kD dynein associated polypeptide
    • 50 kDa dynein associated polypeptide
    • 50 kDa dynein-associated polypeptide
    • DCTN-50
    • DCTN2
    • DCTN2_HUMAN
    • DCTN50
    • dynactin 2
    • dynactin 2 (p50)
    • dynactin complex 50 kD subunit
    • Dynactin complex 50 kDa subunit
    • Dynactin subunit 2
    • DYNAMITIN
    • p50 dynamitin
    • RBP50
    see all
  • Function
    Modulates cytoplasmic dynein binding to an organelle, and plays a role in prometaphase chromosome alignment and spindle organization during mitosis. Involved in anchoring microtubules to centrosomes. May play a role in synapse formation during brain development.
  • Sequence similarities
    Belongs to the dynactin subunit 2 family.
  • Cellular localization
    Cytoplasm > cytoskeleton > centrosome. Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab174453 (3 µg)

References

ab174453 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174453.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up