Description

  • Product name

    Recombinant Human p53 BP3 protein (Tagged)
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      SPDSKCPICLDRFDNVSYLDRCLHKFCFRCVQEWSKNKAECPLCKQPFDS IFHSVRAEDDFKEYVLRPSYNGSFVTPDRRFRYRTTLTRERNASVYSPSG PVNRRTTT
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      98 to 205
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NP_005793

Specifications

Our Abpromise guarantee covers the use of ab160881 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AW105885
    • E3 ubiquitin protein ligase Topors
    • E3 ubiquitin-protein ligase Topors
    • LUN
    • p53 binding protein 3
    • p53 BP3/LUN
    • p53-binding protein 3
    • p53BP3
    • p53BP3/LUN
    • Retinitis pigmentosa 31
    • RP31
    • SUMO1 protein E3 ligase Topors
    • SUMO1-protein E3 ligase Topors
    • Topoisomerase I binding arginine/serine rich
    • Topoisomerase I binding arginine/serine rich protein
    • Topoisomerase I binding protein
    • Topoisomerase I binding RING finger protein
    • Topoisomerase I-binding arginine/serine-rich protein
    • Topoisomerase I-binding RING finger protein
    • Topoisomerase I-binding RS protein
    • Topors
    • TOPRS_HUMAN
    • TP53BPL
    • Tumor protein p53 binding protein
    • Tumor suppressor p53 binding protein 3
    • Tumor suppressor p53-binding protein 3
    see all
  • Function

    Functions as an E3 ubiquitin-protein ligase and as an E3 SUMO1-protein ligase. Probable tumor suppressor involved in cell growth, cell proliferation and apoptosis that regulates p53/TP53 stability through ubiquitin-dependent degradation. May regulate chromatin modification through sumoylation of several chromatin modification-associated proteins. May be involved in DNA damage-induced cell death through IKBKE sumoylation.
  • Tissue specificity

    Expressed at highest levels in testis and at lower levels in adrenal gland, bone marrow, brain, colon, heart, kidney, liver, muscle, ovary, pancreas, placenta, prostate, skeletal muscle, skin, small intestine, spleen, stomach, testis, thymus, thyroid and uterus. Expressed in the alveolar epithelium of the lung. Expression is commonly decreased in colon adenocarcinomas and lung cancers.
  • Involvement in disease

    Defects in TOPORS are the cause of retinitis pigmentosa type 31 (RP31) [MIM:609923]. RP leads to degeneration of retinal photoreceptor cells. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well. RP31 inheritance is autosomal dominant.
  • Sequence similarities

    Contains 1 RING-type zinc finger.
  • Post-translational
    modifications

    Phosphorylation at Ser-98 regulates the E3 ubiquitin-protein ligase activity but not the SUMO1-protein ligase activity. Phosphorylation at Ser-718 increases the E3 ubiquitin-protein ligase activity versus the SUMO1-protein ligase activity resulting in increased p53/TP53 ubiquitination and degradation.
    Sumoylated.
  • Cellular localization

    Nucleus. Nucleus > PML body. Localizes to discrete nuclear foci which partly overlap with PML nuclear bodies. Targeted to PML nuclear bodies upon DNA damage.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab160881, stained with Coomassie Blue.

References

ab160881 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160881.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up