Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGAGATGRAMDGPRLLLLLLLGVSLGGAKEACPTGLYTHSGECCKACNLG EGVAQPCGANQTVCEPCLDSVTFSDVVSATEPCKPCTECVGLQSMSAPCV EADDAVCRCAYGYYQDETTGRCEACRVCEAGSGLVFSCQDKQNTVCEECP DGTYSDEANHVDPCLPCTVCEDTERQLRECTRWADAECEEIPGRWITRST PPEGSDSTAPSTQEPEAPPEQDLIASTVAGVVTTVMGSSQPVVTRGTTDN LIPVYCSILAAVVVGLVAYIAFKRWNSCKQNKQGANSRPVNQTPPPEGEK LHSDSGISVDSQSLHDQQPHTQTASGQALKGDGGLYSSLPPAKREEVEKL LNGSAGDTWRHLAGELGYQPEHIDSFTHEACPVRALLASWATQDSATLDA LLAALRRIQRADLVESLCSESTATSPV
    • Molecular weight

      72 kDa including tags
    • Amino acids

      1 to 427
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab131792 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CD271
    • CD271 antigen
    • Gp80 LNGFR
    • Gp80-LNGFR
    • Low affinity nerve growth factor receptor
    • Low affinity neurotrophin receptor p75NTR
    • Low-affinity nerve growth factor receptor
    • Nerve growth factor receptor
    • Nerve growth factor receptor TNFR superfamily member 16
    • NGF receptor
    • Ngfr
    • p75 ICD
    • p75 Neurotrophin receptor
    • p75 NTR
    • p75(NTR)
    • p75NTR
    • TNFR Superfamily Member 16
    • TNFRSF16
    • TNR16_HUMAN
    • Tumor necrosis factor receptor superfamily member 16
    see all
  • Function

    Low affinity receptor which can bind to NGF, BDNF, NT-3, and NT-4. Can mediate cell survival as well as cell death of neural cells.
  • Sequence similarities

    Contains 1 death domain.
    Contains 4 TNFR-Cys repeats.
  • Domain

    Death domain is responsible for interaction with RANBP9.
    The extracellular domain is responsible for interaction with NTRK1.
  • Post-translational
    modifications

    N- and O-glycosylated.
    O-linked glycans consist of Gal(1-3)GalNAc core elongated by 1 or 2 NeuNAc.
    Phosphorylated on serine residues.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131792 stained with Coomassie Blue.

References

ab131792 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131792.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up