Description

  • Product name

    Recombinant Human p75 NGF Receptor protein
    See all p75 NGF Receptor proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    ab208476 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      KEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPCLDSVTFSDVVS ATEPCKPCTECVGLQSMSAPCVEADDAVCRCAYGYYQDETTGRCEACRVC EAGSGLVFSCQDKQNTVCEECPDGTYSDEANHVDPCLPCTVCEDTERQLR ECTRWADAECEEIPGRWITRSTPPEGSDSTAPSTQEPEAPPEQDLIASTV AGVVTTVMGSSQPVVTRGTTDNLEHHHHHH
    • Predicted molecular weight

      25 kDa including tags
    • Amino acids

      29 to 250
    • Tags

      His tag C-Terminus
    • Additional sequence information

      NP_002498.

Specifications

Our Abpromise guarantee covers the use of ab208476 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 90% PBS, 10% Glycerol

General Info

  • Alternative names

    • CD271
    • CD271 antigen
    • Gp80 LNGFR
    • Gp80-LNGFR
    • Low affinity nerve growth factor receptor
    • Low affinity neurotrophin receptor p75NTR
    • Low-affinity nerve growth factor receptor
    • Nerve growth factor receptor
    • Nerve growth factor receptor TNFR superfamily member 16
    • NGF receptor
    • Ngfr
    • p75 ICD
    • p75 Neurotrophin receptor
    • p75 NTR
    • p75(NTR)
    • p75NTR
    • TNFR Superfamily Member 16
    • TNFRSF16
    • TNR16_HUMAN
    • Tumor necrosis factor receptor superfamily member 16
    see all
  • Function

    Low affinity receptor which can bind to NGF, BDNF, NT-3, and NT-4. Can mediate cell survival as well as cell death of neural cells.
  • Sequence similarities

    Contains 1 death domain.
    Contains 4 TNFR-Cys repeats.
  • Domain

    Death domain is responsible for interaction with RANBP9.
    The extracellular domain is responsible for interaction with NTRK1.
  • Post-translational
    modifications

    N- and O-glycosylated.
    O-linked glycans consist of Gal(1-3)GalNAc core elongated by 1 or 2 NeuNAc.
    Phosphorylated on serine residues.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab208476 (3µg).  The molecular weight is 40-57kDa (SDS-PAGE under reducing conditions).

References

ab208476 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab208476.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up