Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      Theoretical sequence: KEACPTGLYTHSGECCKACNLGEGVAQPCGANQTVCEPC LDSVTFSDVVSATEPCKPCTE CVGLQSMSAPCVEADDAVCRCAYGYYQ DETTGRCEACRVCEAGSGLVFSCQDKQNTVC EECPDGTYSDEANHVDP CLPCTVCEDTERQLRECTRWADAECEEIPGRWITRSTPPEGSD STAPS TQEPEAPPEQDLIASTVAGVVTTVMGSSQPVVTRGTTDNGSSNTKVDKKV EPKSC DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVV VDVSHEDPEVKFNWYVDG VEVHNAKTKPREEQYNSTYRVVSVLTVLHQ DWLNGKEYKCKVSNKALPAPIEKTISKAKGQ PREPQVYTLPPSRDELT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGS FFLY SKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Amino acids

      1 to 250
    • Additional sequence information

      Fusion of aa 1-250 of human NGF receptor and aa 93-330 of Fc region of human IgG1 (P01857). The chimeric protein was expressed in modified human 293 cells.

Specifications

Our Abpromise guarantee covers the use of ab83678 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The ED50 of this chimera is typically 0.7 - 1.0 ug/ml as measured by its ability to neutralize beta NGF mediated proliferation of the human growth factor dependent TF-1 cell line.
  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Constituents: PBS, 1% Human serum albumin, 10% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names

    • CD271
    • CD271 antigen
    • Gp80 LNGFR
    • Gp80-LNGFR
    • Low affinity nerve growth factor receptor
    • Low affinity neurotrophin receptor p75NTR
    • Low-affinity nerve growth factor receptor
    • Nerve growth factor receptor
    • Nerve growth factor receptor TNFR superfamily member 16
    • NGF receptor
    • Ngfr
    • p75 ICD
    • p75 Neurotrophin receptor
    • p75 NTR
    • p75(NTR)
    • p75NTR
    • TNFR Superfamily Member 16
    • TNFRSF16
    • TNR16_HUMAN
    • Tumor necrosis factor receptor superfamily member 16
    see all
  • Function

    Low affinity receptor which can bind to NGF, BDNF, NT-3, and NT-4. Can mediate cell survival as well as cell death of neural cells.
  • Sequence similarities

    Contains 1 death domain.
    Contains 4 TNFR-Cys repeats.
  • Domain

    Death domain is responsible for interaction with RANBP9.
    The extracellular domain is responsible for interaction with NTRK1.
  • Post-translational
    modifications

    N- and O-glycosylated.
    O-linked glycans consist of Gal(1-3)GalNAc core elongated by 1 or 2 NeuNAc.
    Phosphorylated on serine residues.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab83678 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer

Thank you for contacting us and your interest in our products. I am sorry for the delay in getting back to you.
Currently, only the p75 NGF Receptor protein ab83678 has been shown to have biological activity. This has been performed by measuring the proteins ability to neutralize beta NGF mediated proliferation of the human growth factor dependent TF-1 cell line. The ED50 of the ab83678 chimera is typically 0.7 - 1.0 ug/ml.
This does not mean that the ab83679 would not show any biological activity, simply that we have not tested it ourselves yet and would therefore not be able to guarantee its activity.
I hope this information has been of some help. If I can be of any further assistance, please do not hesitate to contact us again.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up