Overview

  • Product name

    Recombinant Human p92 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      AVEVDRQFDGAAVQVRVRMGTEPRHFMAIFKGKLVIFEGGTSRKGNAEPD PPVRLFQIHGNDKSNTKAVEVPAFASSLNSNDVFLLRTQAEHYLWY
    • Amino acids

      460 to 555
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161106 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Advillin. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Actin binding protein DOC 6
    • Actin binding protein DOC6
    • Advil
    • Advillin
    • AVIL
    • AVIL_HUMAN
    • DOC 6
    • DOC6
    • p92
    see all
  • Function

    Ca(2+)-regulated actin-binding protein. May have a unique function in the morphogenesis of neuronal cells which form ganglia. Required for SREC1-mediated regulation of neurite-like outgrowth. Plays a role in regenerative sensory axon outgrowth and remodeling processes after peripheral injury in neonates. Involved in the formation of long fine actin-containing filopodia-like structures in fibroblast. Plays a role in ciliogenesis.
  • Tissue specificity

    Most highly expressed in the small intestine and colonic lining. Weaker expression also detected in the thymus, prostate, testes and uterus.
  • Sequence similarities

    Belongs to the villin/gelsolin family.
    Contains 6 gelsolin-like repeats.
    Contains 1 HP (headpiece) domain.
  • Cellular localization

    Cytoplasm > cytoskeleton. Cell projection. Cell projection > axon.
  • Information by UniProt

Images

  • ab161106 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161106 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161106.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up