Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSGEPNPAGKKKKYLKAALYVGDLDPDVTEDMLYKKFRPAGPLRFTRIC RDPVTRSPLGYGYVNFRFPADAEWALNTMNFDLINGKPFRLMWSQPDDRL RKSGVGNIFIKNLDKSIDNRALFYLFSAFGNILSCKVVCDDNGSKGYAYV HFDSLAAANRAIWHMNGVRLNNRQVYVGRFKFPEERAAEVRTRDRATFTN VFVKNIGDDIDDEKLKELFCEYGPTESVKVIRDASGKSKGFGFVRYETHE AAQKAVLDLHGKSIDGKVLYVGRAQKKIERLAELRRRFERLRLKEKSRPP GVPIYIKNLDETINDEKLKEEFSSFGSISRAKVMMEVGQGKGFGVVCFSS FEEATKAVDEMNGRIVGSKPLHVTLGQARRRC
    • Amino acids
      1 to 382
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165484 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • PABP5
    • Poly(A) binding protein 5
    • Poly(A) binding protein cytoplasmic 5
    • Polyadenylate binding protein 5
  • Relevance
    PABPC5 (polyadenylate-binding protein 5) binds the polyadenylate tail of mRNA and is thought to be involved in cytoplasmic regulatory processes of mRNA metabolism. In vivo, it may also bind to cytoplasmic RNA sequences other than polyadenylate.
  • Cellular localization
    Cytoplasmic

Images

  • ab165484 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165484 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165484.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up