Description

  • Product name

    Recombinant Human PABPN1 protein (denatured)
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSLEAIKARVREMEEEAEKLKELQNEVEK QMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGC GSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVI PKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRG RARATSWYSPY
    • Predicted molecular weight

      24 kDa including tags
    • Amino acids

      119 to 306
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_004634.

Specifications

Our Abpromise guarantee covers the use of ab177635 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names

    • Nuclear poly(A)-binding protein 1
    • OPMD
    • PAB2
    • PABII
    • PABP 2
    • pABP-2
    • PABP2
    • PABP2_HUMAN
    • PABPII
    • Pabpn1
    • poly(A) binding protein nuclear 1
    • Poly(A)-binding protein 2
    • Poly(A)-binding protein II
    • PolyA binding protein II
    • Polyadenylate-binding nuclear protein 1
    • Polyadenylate-binding protein 2
    see all
  • Function

    Involved in the 3'-end formation of mRNA precursors (pre-mRNA) by the addition of a poly(A) tail of 200-250 nt to the upstream cleavage product. Stimulates poly(A) polymerase (PAPOLA) conferring processivity on the poly(A) tail elongation reaction and controls also the poly(A) tail length. Increases the affinity of poly(A) polymerase for RNA. Is also present at various stages of mRNA metabolism including nucleocytoplasmic trafficking and nonsense-mediated decay (NMD) of mRNA. Cooperates with SKIP to synergistically activate E-box-mediated transcription through MYOD1 and may regulate the expression of muscle-specific genes. Binds to poly(A) and to poly(G) with high affinity. May protect the poly(A) tail from degradation.
  • Tissue specificity

    Ubiquitous.
  • Involvement in disease

    Defects in PABPN1 are the cause of oculopharyngeal muscular dystrophy (OPMD) [MIM:164300]. OPMD is a form of late-onset slowly progressive myopathy characterized by eyelid ptosis, dysphagia and, sometimes by other cranial and limb-muscle involvement.
  • Sequence similarities

    Contains 1 RRM (RNA recognition motif) domain.
  • Domain

    The RRM domain is essential for specific adenine bases recognition in the poly(A) tail but not sufficient for poly(A) binding.
  • Post-translational
    modifications

    Arginine dimethylation is asymmetric and involves PRMT1 and PRMT3. It does not influence the RNA binding properties.
  • Cellular localization

    Nucleus. Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Shuttles between the nucleus and the cytoplasm but predominantly found in the nucleus. Its nuclear import may involve the nucleocytoplasmic transport receptor transportin and a RAN-GTP-sensitive import mechanism. Is exported to the cytoplasm by a carrier-mediated pathway that is independent of mRNA traffic. Nucleus; nuclear speckle. Colocalizes with SKIP and poly(A) RNA in nuclear speckles.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab177635 (3µg).

References

ab177635 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177635.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up