Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MRLSLPLLLLLLGAWAIPGGLGDRAPLTATAPQLDDEEMYSAHMPAHLRC DACRAVAYQMWQNLAKAETKLHTSNSGGRRELSELVYTDVLDRSCSRNWQ DYGVREVDQVKRLTGPGLSEGPEPSISVMVTGGPWPTRLSRTCLHYLGEF GEDQIYEAHQQGRGALEALLCGGPQGACSEKVSATREEL
    • Amino acids

      1 to 189
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162468 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as Proapoptotic Caspase Adaptor Protein

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • MZB1
    • Caspase 2 binding protein
    • FLJ32987
    • HSPC190
    • Marginal zone B and B1 cell specific protein
    • Marginal zone B- and B1-cell-specific protein
    • MEDA 7
    • MEDA-7
    • Mesenteric estrogen dependent adipose 7
    • Mesenteric estrogen-dependent adipose 7
    • Mesenteric oestrogen dependent adipose gene 7
    • MGC29506
    • Mzb1
    • MZB1_HUMAN
    • PACAP
    • pERp1
    • Plasma cell-induced ER protein 1
    • Plasma cell-induced resident endoplasmic reticulum protein
    • Plasma cell-induced resident ER protein
    • Proapoptotic caspase adapter protein
    see all
  • Function

    Associates with immunoglobulin M (IgM) heavy and light chains and promotes IgM assembly and secretion. May exert its effect by acting as a molecular chaperone or as an oxidoreductase as it displays a low level of oxidoreductase activity (By similarity). Isoform 2 may be involved in regulation of apoptosis. Helps to diversify peripheral B-cell functions by regulating Ca(2+) stores, antibody secretion and integrin activation.
    Acts as a hormone-regulated adipokine/proinflammatory cytokine that is implicated in causing chronic inflammation, affecting cellular expansion and blunting insulin response in adipocytes. May have a role in the onset of insulin resistance.
  • Tissue specificity

    Widely expressed with highest levels in adult brain, small intestine and lymphoid tissues such as thymus and spleen. Expression is frequently lower in intestinal-type gastric cancer. In obese patients, more abundant in omental than in subcutaneous fat.
  • Sequence similarities

    Belongs to the MZB1 family.
  • Post-translational
    modifications

    Forms an interchain disulfide bond with IgM monomers.
  • Cellular localization

    Endoplasmic reticulum lumen. Secreted and Cytoplasm. Diffuse granular localization in the cytoplasm surrounding the nucleus (PubMed:11350957).
  • Information by UniProt

Images

  • ab162468 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162468 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162468.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up