Description

  • Product name

    Recombinant Human PACAP receptor/ADCYAP1R1 protein
    See all PACAP receptor/ADCYAP1R1 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MHSDCIFKKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVG EMVLVSCPELFRIFNPDQVWETETIGESDFGDSNSLDLSDMGVVSRNCTE
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      21 to 120

Specifications

Our Abpromise guarantee covers the use of ab114647 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

     This product was previously labelled as PACAP receptor

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • ADCYAP1 R1
    • ADCYAP1R 1
    • ADCYAP1R1
    • Adenylate cyclase activating polypeptide 1 (pituitary) receptor type 1
    • Adenylate cyclase activating polypeptide 1 (pituitary) receptor type I
    • PAC 1
    • PAC1
    • PAC1R
    • PACAP receptor 1
    • PACAP type I receptor
    • PACAP-R-1
    • PACAP-R1
    • PACAP1 R
    • PACAPR
    • PACAPRI
    • PACR_HUMAN
    • Pituitary adenylate cyclase activating polypeptide 1 receptor type I Hiphop
    • Pituitary adenylate cyclase activating polypeptide receptor
    • Pituitary adenylate cyclase activating polypeptide type I receptor precursor
    • Pituitary adenylate cyclase-activating polypeptide 1, receptor for
    • Pituitary adenylate cyclase-activating polypeptide type I receptor
    • pvr1
    see all
  • Function

    This is a receptor for PACAP-27 and PACAP-38. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase. May regulate the release of adrenocorticotropin, luteinizing hormone, growth hormone, prolactin, epinephrine, and catecholamine. May play a role in spermatogenesis and sperm motility. Causes smooth muscle relaxation and secretion in the gastrointestinal tract.
  • Tissue specificity

    Most abundant in the brain, low expression in the lung, liver, thymus, spleen, pancreas and placenta.
  • Sequence similarities

    Belongs to the G-protein coupled receptor 2 family.
  • Cellular localization

    Cell membrane.
  • Information by UniProt

Images

  • ab114647 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114647 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114647.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up