Description

  • Product name

    Recombinant Human PACE4 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCRRCDENCLSCA GSSRNCSRCKTGFTQLGTSCITNHTCSNADETFCEMVKSNRLCERKLFIQ FCCRTCLLAG
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      860 to 969

Specifications

Our Abpromise guarantee covers the use of ab114961 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Paired basic amino acid cleaving enzyme 4
    • Paired basic amino acid cleaving system 4
    • PCSK6
    • PCSK6_HUMAN
    • Proprotein convertase subtilisin/kexin type 6
    • SPC4
    • Subtilisin like protease
    • Subtilisin-like proprotein convertase 4
    • subtilisin/kexin like protease PACE4
    • Subtilisin/kexin-like protease PACE4
    see all
  • Function

    Likely to represent an endoprotease activity within the constitutive secretory pathway, with unique restricted distribution in both neuroendocrine and non-neuroendocrine tissues and capable of cleavage at the RX(K/R)R consensus motif.
  • Tissue specificity

    Each PACE4 isoform exhibits a unique restricted distribution. Isoform PACE4A-I is expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, but at comparatively higher levels in the liver. Isoform PACE4A-II is at least expressed in placenta. Isoform PACE4B was only found in the embryonic kidney cell line from which it was isolated. Isoform PACE4C and isoform PACE4D are expressed in placenta. Isoform PACE4E-I is expressed in cerebellum, placenta and pituitary. Isoform PACE4E-II is at least present in cerebellum.
  • Sequence similarities

    Belongs to the peptidase S8 family.
    Contains 1 homo B/P domain.
    Contains 1 PLAC domain.
  • Domain

    The propeptide domain acts as an intramolecular chaperone assisting the folding of the zymogen within the endoplasmic reticulum. Isoform PACE4D lacks the propeptide domain.
  • Cellular localization

    Secreted; Endomembrane system. Retained intracellularly probably through a hydrophobic cluster in their C-terminus and Endoplasmic reticulum. Not secreted, remains probably in zymogen form in endoplasmic reticulum.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114961 at approximately 37.73kDa.
    Stained with Coomassie Blue.

References

ab114961 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114961.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up