Description

  • Product name

    Recombinant Human PACSIN1 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSSSYDEASLAPEETTDSFWEVGNYKRTVKRIDDGHRLCNDLMNCVQERA KIEKAYGQQLTDWAKRWRQLIEKGPQYGSLERAWGAIMTEADKVSELHQE VKNNLLNEDLEKVKNWQKDAYHKQIMGGFKETKEAEDGFRKAQKPWAKKM KELEAAKKAYHLACKEEKLAMTREMNSKTEQSVTPEQQKKLQDKVDKCKQ DVQKTQEKYEKVLEDVGKTTPQYMENMEQVFEQCQQFEEKRLVFLKEVLL DIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWP QFEEWNPDLPHTTTKKEKQPKKAEGVALTNATGAVESTSQAGDRGSVSSY DRGQPYATEWSDDESGNPFGGSETNGGANPFEDDSKGVRVRALYDYDGQE QDELSFKTGDELTKLGEEDEQGWCRGRLDSGQLGLYPANYVEAI
    • Predicted molecular weight

      75 kDa including tags
    • Amino acids

      1 to 444

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131867 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • A830061D09Rik
    • Dynamin PRD-interacting protein
    • Dynamin proline-rich domain-interacting protein
    • H74
    • KIAA1379
    • MGC114042
    • MGC56324
    • mKIAA1379
    • OTTHUMP00000016231
    • PACN1_HUMAN
    • Pacsin1
    • PASCIN
    • Protein kinase C and casein kinase substrate in neurons 1
    • Protein kinase C and casein kinase substrate in neurons protein 1
    • SDPI
    • Synaptic, dynamin-associated protein I
    • Syndapin
    • Syndapin 1
    • Syndapin-I
    • zgc:114042
    • zgc:56324
    see all
  • Function

    May play a role in vesicle formation and transport.
  • Tissue specificity

    Highly expressed in brain and in a lesser extent in heart, pancreas and liver.
  • Sequence similarities

    Belongs to the PACSIN family.
    Contains 1 FCH domain.
    Contains 1 SH3 domain.
  • Post-translational
    modifications

    Phosphorylated by casein kinase 2 (CK2) and protein kinase C (PKC).
  • Cellular localization

    Cytoplasm. Colocalizes with dynamin I at vesicular structures in the cell body and neurites.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131867 stained with Coomassie Blue.

References

ab131867 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131867.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up