Overview

  • Product name

    Recombinant Human PACSIN2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERAR IEKAYAQQLTEWARRWRQLVEKGPQYGTVEKAWMAFMSEAERVSELHLEV KASLMNDDFEKIKNWQKEAFHKQMMGGFKETKEAEDGFRKAQKPWAKKLK EVEAAKKAHHAACKEEKLAISREANSKADPSLNPEQLKKLQDKIEKCKQD VLKTKEKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKRLRFFREVLLE VQKHLDLSNVAGYKAIYHDLEQSIRAADAVEDLRWFRANHGPGMAMNWPQ FEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQSLPSKPSSTLNVPSN PAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWSD DESNNPFSSTDANGDSNPFDDDATSGTEVRVRALYDYEGQEHDELSFKAG DELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEAIQ
    • Amino acids

      1 to 486
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153173 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • cytoplasmic phosphoprotein PACSIN2
    • OTTHUMP00000198281
    • OTTHUMP00000198282
    • OTTHUMP00000198283
    • OTTHUMP00000198284
    • PACN2_HUMAN
    • Pacsin2
    • protein kinase C and casein kinase substrate in neurons 2
    • Protein kinase C and casein kinase substrate in neurons protein 2
    • SDPII
    • Syndapin II
    see all
  • Function

    May play a role in vesicle formation and transport.
  • Tissue specificity

    Ubiquitously expressed.
  • Sequence similarities

    Belongs to the PACSIN family.
    Contains 1 FCH domain.
    Contains 1 SH3 domain.
  • Post-translational
    modifications

    Phosphorylated by casein kinase 2 (CK2) and protein kinase C (PKC).
  • Cellular localization

    Cytoplasmic vesicle. Vesicle-like cytoplasmic distribution.
  • Information by UniProt

Images

  • ab153173 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153173 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153173.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up