Description

  • Product name

    Recombinant human PADI1 / PAD1 protein
    See all PADI1 / PAD1 proteins and peptides
  • Biological activity

    Specific Activity: ≥35 pmol/min/μg


    Assay Conditions: Enzyme reaction was performed in a buffer (50 mM Tris, pH 7.4, 50 mM NaCl, 10 mM CaCl2, and 2 mM DTT) containing ab196400 and 10 mM BAEE as a substrate for 25 min at 37°C. Amount of ammonia produced was measured and used for specific activity calculation.

  • Purity

    > 70 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAPKRVVQLSLKMPTHAVCVVGVEAHVDIHSDVPKGANSFRVSGSSGVEV FMVYNRTRVKEPIGKARWPLDTDADMVVSVGTASKELKDFKVRVSYFGEQ EDQALGRSVLYLTGVDISLEVDTGRTGKVKRSQGDKKTWRWGPEGYGAIL LVNCDRDNHRSAEPDLTHSWLMSLADLQDMSPMLLSCNGPDKLFDSHKLV LNVPFSDSKRVRVFCARGGNSLSDYKQVLGPQCLSYEVERQPGEQEIKFY VEGLTFPDADFLGLVSLSVSLVDPGTLPEVTLFTDTVGFRMAPWIMTPNT QPPEELYVCRVMDTHGSNEKFLEDMSYLTLKANCKLTICPQVENRNDRWI QDEMEFGYIEAPHKSFPVVFDSPRNRGLKDFPYKRILGPDFGYVTREIPL PGPSSLDSFGNLDVSPPVTVGGTEYPLGRILIGSSFPKSGGRQMARAVRN FLKAQQVQAPVELYSDWLSVGHVDEFLTFVPTSDQKGFRLLLASPSACLK LFQEKKEEGYGEAAQFDGLKHQAKRSINEMLADRHLQRDNLHAQKCIDWN RNVLKRELGLAESDIVDIPQLFFLKNFYAEAFFPDMVNMVVLGKYLGIPK PYGPIINGRCCLEEKVQSLLEPLGLHCIFIDDYLSYHELQGEIHCGTNVR RKPFPFKWWNMVP
    • Predicted molecular weight

      75 kDa including tags
    • Amino acids

      1 to 663
    • Tags

      DDDDK tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab196400 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.71% Tris HCl, 0.72% Sodium chloride, 0.02% Potassium chloride, 10% Glycerol, 0.05% DTT

    90 µg/ml DDDDK peptide

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • HPAD10
    • Padi1
    • PADI1_HUMAN
    • PDI
    • PDI1
    • Peptidylarginine deiminase I
    • protein arginine deiminase type I
    • Protein-arginine deiminase type I
    • Protein-arginine deiminase type-1
    see all
  • Function

    Catalyzes the deimination of arginine residues of proteins.
  • Tissue specificity

    Epidermis, prostate, testis, placenta, spleen and thymus.
  • Sequence similarities

    Belongs to the protein arginine deiminase family.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • Example of specific activity of ab196400

  • 10% SDS-PAGE analysis of ab196400 (5 μg) with Coomassie staining.

References

ab196400 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196400.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up