Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSLQRIVRVSLEHPTSAVCVAGVETLVDIYGSVPEGTEMFEVYGTPGVDI YISPNMERGRERADTRRWRFDATLEIIVVMNSPSNDLNDSHVQISYHSSH EPLPLAYAVLYLTCVDISLDCDLNCEGRQDRNFVDKRQWVWGPSGYGGIL LVNCDRDDPSCDVQDNCDQHVHCLQDLEDMSVMVLRTQGPAALFDDHKLV LHTSSYDAKRAQVFHICGPEDVCEAYRHVLGQDKVSYEVPRLHGDEERFF VEGLSFPDAGFTGLISFHVTLLDDSNEDFSASPIFTDTVVFRVAPWIMTP STLPPLEVYVCRVRNNTCFVDAVAELARKAGCKLTICPQAENRNDRWIQD EMELGYVQAPHKTLPVVFDSPRNGELQDFPYKRILGPDFGYVTREPRDRS VSGLDSFGNLEVSPPVVANGKEYPLGRILIGGNLPGSSGRRVTQVVRDFL HAQKVQPPVELFVDWLAVGHVDEFLSFVPAPDGKGFRMLLASPGACFKLF QEKQKCGHGRALLFQGVVDDEQVKTISINQVLSNKDLINYNKFVQSCIDW NREVLKRELGLAECDIIDIPQLFKTERKKATAFFPDLVNMLVLGKHLGIP KPFGPIINGCCCLEEKVRSLLEPLGLHCTFIDDFTPYHMLHGEVHCGTNV CRKPFSFKWWNMVP
    • Molecular weight
      75 kDa including tags
    • Amino acids
      1 to 664
    • Tags
      DDDDK tag C-Terminus
    • Additional sequence information
      (NM_016233).

Specifications

Our Abpromise guarantee covers the use of ab196421 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Specific Activity: ≥22 pmole/min/µg.

    Enzyme reaction was performed in a buffer (50 mM Tris, pH 7.4, 50 mM NaCl, 10 mM CaCl2, and 2 mM DTT) containing PADI and 10 mM BAEE as a substrate for 25 min at 37°C.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity
    >= 53 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.05% DTT

    Contains 80 µg/ml DDDDK peptide.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • PADI3
    • PADI3_HUMAN
    • PDI3
    • Peptidyl arginine deiminase, type III
    • Peptidylarginine deiminase III
    • Protein arginine deiminase type 3
    • Protein arginine deiminase type III
    • Protein-arginine deiminase type III
    • Protein-arginine deiminase type-3
    see all
  • Function
    Catalyzes the deimination of arginine residues of proteins.
  • Tissue specificity
    Hair follicles, and epidermis at very low levels.
  • Sequence similarities
    Belongs to the protein arginine deiminase family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 10% SDS-PAGE analysis of 2.85 µg ab196421 with Coomassie staining.

  • Activity assay of ab196421.

References

ab196421 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab196421.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up